Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit

To Order Contact us below: zachary@wildpalm.net

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx122471-100ug 100 ug
EUR 391

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-400ul 400 ul
EUR 523

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx025732-80l 80 µl
EUR 286

Beta-Carotene-15,15-Monooxygenase 1 (bCMO1) Antibody

20-abx171410
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug

beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody

abx230851-100ug 100 ug
EUR 481

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

SEE246Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids.

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit

20-abx150797
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT

ELI-10937h 96 Tests
EUR 824

Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein

20-abx650585
  • EUR 676.00
  • EUR 286.00
  • EUR 2082.00
  • EUR 801.00
  • EUR 481.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug

Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT

ELI-11036m 96 Tests
EUR 865

Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit

20-abx494551
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1)

ELK4791 1 plate of 96 wells
EUR 432
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit

4-SEE246Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human)

4-PAE246Hu01
  • EUR 247.00
  • EUR 2510.00
  • EUR 625.00
  • EUR 310.00
  • EUR 214.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1)

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC

4-PAE246Hu01-APC
  • EUR 345.00
  • EUR 3275.00
  • EUR 912.00
  • EUR 440.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated

4-PAE246Hu01-Biotin
  • EUR 311.00
  • EUR 2460.00
  • EUR 727.00
  • EUR 381.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3

4-PAE246Hu01-Cy3
  • EUR 419.00
  • EUR 4325.00
  • EUR 1175.00
  • EUR 545.00
  • EUR 251.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC

4-PAE246Hu01-FITC
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP

4-PAE246Hu01-HRP
  • EUR 316.00
  • EUR 2855.00
  • EUR 807.00
  • EUR 398.00
  • EUR 206.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP.

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE

4-PAE246Hu01-PE
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE.

Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit

abx392200-96tests 96 tests
EUR 911

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody

20-abx310811
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7

4-PAE246Hu01-APC-Cy7
  • EUR 571.00
  • EUR 6430.00
  • EUR 1705.00
  • EUR 760.00
  • EUR 319.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7.

Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx388677-96tests 96 tests
EUR 911

Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit

abx391017-96tests 96 tests
EUR 911

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP)

20-abx310812
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC)

20-abx310813
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin)

20-abx310814
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

beta-Carotene

GP8334-10G 10 g
EUR 102

beta-Carotene

GP8334-1G 1 g
EUR 48

beta-Carotene

GP8334-25G 25 g
EUR 174

beta-Carotene

GP8334-5G 5 g
EUR 74

Beta-Carotene

TB0299 8XX100mg
EUR 274

Human beta carotene

QY-E05643 96T
EUR 361

Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed

ELISA-1 1
EUR 202

Bcmo1/ Rat Bcmo1 ELISA Kit

ELI-33406r 96 Tests
EUR 886

Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0265Hu 1 Kit
EUR 605

Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx250481-96tests 96 tests
EUR 668

ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase

EK2713 96 tests
EUR 553
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids.

Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit

EH1224 96T
EUR 567.6
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml

Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT

ELI-49386h 96 Tests
EUR 824

Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit

E0170Mo 1 Kit
EUR 632

Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit

abx515122-96tests 96 tests
EUR 739

Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT

ELI-49387m 96 Tests
EUR 865

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 477

BCMO1 ELISA Kit (Human) (OKCD04382)

OKCD04382 96 Wells
EUR 831
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL

Human TGF-beta-1 AssayMax ELISA Kit

ET3102-1 96 Well Plate
EUR 477

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx122472-100ug 100 ug
EUR 391

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

20-abx003844
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul

Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody

abx230852-100ug 100 ug
EUR 481

Chicken BCMO1 ELISA KIT

ELI-25375c 96 Tests
EUR 928

Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EMI2200-1 96 Well Plate
EUR 477

YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein

PROTP31946-1 Regular: 25ug
EUR 317
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques.

β-Carotene

HY-N0411 50mg
EUR 108

alpha-Carotene

TBZ2607 5mg Ask for price

Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx385151-96tests 96 tests
EUR 911

Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23191h 96 Tests
EUR 824

BCMO1 siRNA

20-abx909008
  • EUR 551.00
  • EUR 732.00
  • 15 nmol
  • 30 nmol

BCMO1 siRNA

20-abx909009
  • EUR 551.00
  • EUR 732.00
  • 15 nmol
  • 30 nmol

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

SEF458Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

4-SEF458Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-48Tests 48 Tests
EUR 521

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RD-FMO1-Hu-96Tests 96 Tests
EUR 723

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-48T 48T
EUR 517
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

DLR-FMO1-Hu-96T 96T
EUR 673
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids.

Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit

abx381498-96tests 96 tests
EUR 911

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

20-abx151570
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-48Tests 48 Tests
EUR 544

Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit

RDR-FMO1-Hu-96Tests 96 Tests
EUR 756

Human BCMO1 shRNA Plasmid

20-abx959976
  • EUR 801.00
  • EUR 1121.00
  • 150 µg
  • 300 µg

BCMO1 Recombinant Protein (Human)

RP036973 100 ug Ask for price

BCMO1 Recombinant Protein (Human)

RP036976 100 ug Ask for price

Human SQLE/ Squalene monooxygenase ELISA Kit

E2385Hu 1 Kit
EUR 605

Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit

201-12-2419 96 tests
EUR 440
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Alkylglycerol Monooxygenase(AGMO)ELISA Kit

QY-E01119 96T
EUR 361

Human Alkylglycerol monooxygenase, AGMO ELISA KIT

ELI-24195h 96 Tests
EUR 824

Human Squalene monooxygenase, SQLE ELISA KIT

ELI-32784h 96 Tests
EUR 824

Kynurenine 3-monooxygenase ELISA Kit|Human

EF005180 96 Tests
EUR 689

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Alkylglycerol monooxygenase(TMEM195) ELISA kit

E01A2009-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody

EXOAB-KIT-1 25 ul each
EUR 627

Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx389876-96tests 96 tests
EUR 911

Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit

abx391608-96tests 96 tests
EUR 911

Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-23404c 96 Tests
EUR 928

Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT

ELI-42078p 96 Tests
EUR 928

Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT

ELI-45646m 96 Tests
EUR 865

mRNAExpress mRNA Synthesis kit (5 reactions)

MR-KIT-1 5 reactions
EUR 1152

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx241015
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx241094
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx214774
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx214826
  • EUR 411.00
  • EUR 300.00
  • 100 ul
  • 50 ul

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

20-abx329250
  • EUR 314.00
  • EUR 244.00
  • 100 ug
  • 50 ug

Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody

abx332554-100ul 100 ul
EUR 425

PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN320A-KIT 1 Kit
EUR 4941

Recombinant Human Heregulin Beta -1 Protein

PROTQ02297-1 50ug
EUR 317
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues).

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit

EM5001-1 96 Well Plate
EUR 417

BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1)

K0177302 1.0 ug DNA
EUR 154

PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1)

PIN340iPS-KIT 1 Kit
EUR 4941

Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit

EF018966 96 Tests
EUR 689

Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit

EF015513 96 Tests
EUR 689

MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit

EF012392 96 Tests
EUR 689

ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1)

ELK4594 1 plate of 96 wells
EUR 432
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT

ELI-43781h 96 Tests
EUR 824

BCMO1 cloning plasmid

CSB-CL864015HU1-10ug 10ug
EUR 376
Description: A cloning plasmid for the BCMO1 gene.

BCMO1 cloning plasmid

CSB-CL864015HU2-10ug 10ug
EUR 570
Description: A cloning plasmid for the BCMO1 gene.

BCMO1 Polyclonal Antibody

29452-100ul 100ul
EUR 252

BCMO1 Polyclonal Antibody

29452-50ul 50ul
EUR 187

BCMO1 Rabbit pAb

A15848-100ul 100 ul
EUR 308

BCMO1 Rabbit pAb

A15848-200ul 200 ul
EUR 459

BCMO1 Rabbit pAb

A15848-20ul 20 ul
EUR 183

BCMO1 Rabbit pAb

A15848-50ul 50 ul
EUR 223

anti- BCMO1 antibody

FNab00851 100µg
EUR 505.25
Description: Antibody raised against BCMO1

Anti-BCMO1 antibody

PAab00851 100 ug
EUR 355

Beta-Amyloid (1-11)

A1002-1 1 mg
EUR 102
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag

PROTP10749-1 Regular: 25ug
EUR 317
Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques.

BCMO1 ORF Vector (Human) (pORF)

ORF012325 1.0 ug DNA
EUR 354

BCMO1 ORF Vector (Human) (pORF)

ORF012326 1.0 ug DNA
EUR 354

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

SEH755Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

SEH755Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

SEH755Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

SEH755Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids.

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

4-SEH755Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species.

ELISA kit for Human Squalene monooxygenase (SQLE)

KTE60353-48T 48T
EUR 332
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Squalene monooxygenase (SQLE)

KTE60353-5platesof96wells 5 plates of 96 wells
EUR 2115
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Squalene monooxygenase (SQLE)

KTE60353-96T 96T
EUR 539
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

RD-KMO-Hu-48Tests 48 Tests
EUR 521

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

RD-KMO-Hu-96Tests 96 Tests
EUR 723

Human TH/ Tyrosine 3-monooxygenase ELISA Kit

E2487Hu 1 Kit
EUR 571

Human KMO/ Kynurenine 3-monooxygenase ELISA Kit

E1395Hu 1 Kit
EUR 605

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

DLR-KMO-Hu-48T 48T
EUR 517
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

DLR-KMO-Hu-96T 96T
EUR 673
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids.

Human Kynurenine 3-monooxygenase (KMO) ELISA Kit

abx573591-96tests 96 tests
EUR 668

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

20-abx152142
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit

abx386638-96tests 96 tests
EUR 911

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

RDR-KMO-Hu-48Tests 48 Tests
EUR 544

Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit

RDR-KMO-Hu-96Tests 96 Tests
EUR 756

Human Deoxyhypusine Hydroxylase/Monooxygenase(DOHH)ELISA Kit

QY-E01153 96T
EUR 361

Human Kynurenine-3-Monooxygenase(KMO)ELISA Kit

QY-E01801 96T
EUR 361

Human KMO(Kynurenine 3-monooxygenase) ELISA Kit

EH14776 96T
EUR 567.6
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Human TH(Tyrosine 3-monooxygenase) ELISA Kit

EH1602 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml

Human Kynurenine 3- monooxygenase, KMO ELISA KIT

ELI-46405h 96 Tests
EUR 824

Human Tyrosine 3- monooxygenase, TH ELISA KIT

ELI-04696h 96 Tests
EUR 824

Human Kynurenine 3 monooxygenase(KMO) ELISA kit

E01K0092-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Kynurenine 3 monooxygenase(KMO) ELISA kit

E01K0092-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Kynurenine 3 monooxygenase(KMO) ELISA kit

E01K0092-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1)

PIN300A-KIT 1 Kit
EUR 2798

ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

KTE61571-48T 48T
EUR 332
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

KTE61571-5platesof96wells 5 plates of 96 wells
EUR 2115
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1)

KTE61571-96T 96T
EUR 539
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

E01D0299-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

E01D0299-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit

E01D0299-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9

PROTP05556-1 Regular: 10ug
EUR 317
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques. 

Human Flavin Containing Monooxygenase 1 (FMO1) CLIA Kit

20-abx494912
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

IL-1 beta, rat recombinant

P1019-1 1 mg
EUR 7288
Description: Interleukin 1 beta (IL-1?) is a proinflammatory cytokine and is produced by activated macrophages, monocytes, keratinocytes and other epithelial cells. Both IL-1? and IL-1? bind to the same receptor and have similar biological properties.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 Regular: 2.5ug
EUR 1157
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

PinPoint-HR System for Platform Cell Line Generation & Retargeting (includes PIN400A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

PIN400A-KIT 1 Kit
EUR 2798

T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents)

CAS510A-KIT 1 Kit
EUR 805

Human SIRP BETA 1 (SIRP BETA 1) ELISA Kit

abx259843-96tests 96 tests
EUR 911

PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, GE601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

PIN410A-KIT 1 Kit
EUR 4335

PinPoint-HR System for Platform Cell Line Generation & Retargeting of AAVS1 Safe Harbor Locus (includes PIN410A-1, CAS601A-1, PIN200A-1, PIN510A-1, & PIN600A-1)

PIN412A-KIT 1 Kit
EUR 4335

Luciferase Firefly, Luciferin 4-Monooxygenase Firefly Recombinant Protein, Active

PROTP08659-1 Regular: 5ug
EUR 317
Description: Luciferase produced in E.Coli is a single, non-glycosylated polypeptide chain containing 335 amino acids (1-311 a.a) and having a molecular mass of 38.5kDa.; Luciferase is fused to a 24 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 Regular: 10ug
EUR 317
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

YWHAE Tyr-3/Trp- 5 Monooxygenase Activation Protein Epsilon Human Recombinant Protein

PROTP62258-1 Regular: 20ug
EUR 317
Description: YWHAE Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 255 amino acids (1-255) and having a molecular mass of 29 kDa. ;YWHAE is purified by proprietary chromatographic techniques.

TPSAB1 Human, Tryptase Alpha/Beta 1 Human Recombinant Protein, Sf9

PROTQ15661-1 Regular: 10ug
EUR 317
Description: TPSAB1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (31-275 a.a.) and fused to a 6 aa His Tag at C-terminus containing a total of 251 amino acids and having a molecular mass of 28.2kDa.TPSAB1 shows multiple bands between 28-40kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques. 

ATP1B1 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9

PROTP05026-1 Regular: 10ug
EUR 317
Description: ATP1B1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 250 amino acids (63-303 a.a.) and having a molecular mass of 29kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa).;ATP1B1 is expressed with a 6 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

ATP1B2 Human, ATPase Transporting Beta 1 Human Recombinant Protein, Sf9

PROTP14415-1 Regular: 10ug
EUR 317
Description: ATP1B2 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 232 amino acids (68-290a.a.) and having a molecular mass of 26.4kDa (Molecular size on SDS-PAGE will appear at approximately 28-40 kDa). ATP1B2 is expressed with a 9 amino acid His tag at C-Terminus and purified by proprietary chromatographic techniques.

ER beta-1 (Estrogen Receptor beta-1); Clone ERb455 (Concentrate)

RA0111-C.1 0.1 ml
EUR 125

Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

GA-E0825RT-48T 48T
EUR 317

Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

GA-E0825RT-96T 96T
EUR 496

Rat Squalene monooxygenase (SQLE) ELISA Kit

abx392005-96tests 96 tests
EUR 911

Mouse Squalene monooxygenase (SQLE) ELISA Kit

abx390641-96tests 96 tests
EUR 911

Tyrosine 3-monooxygenase (TH) ELISA Kit

20-abx258488
  • EUR 7237.00
  • EUR 3855.00
  • EUR 895.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Rat Alkylglycerol Monooxygenase(AGMO)ELISA Kit

QY-E10827 96T
EUR 361

Mouse Alkylglycerol Monooxygenase(AGMO)ELISA Kit

QY-E20067 96T
EUR 361

Mouse Alkylglycerol monooxygenase, Agmo ELISA KIT

ELI-24173m 96 Tests
EUR 865

Mouse Squalene monooxygenase, Sqle ELISA KIT

ELI-26561m 96 Tests
EUR 865

Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

E02A2009-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

E02A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit

E02A2009-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

E08A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

E08A2009-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit

E08A2009-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

E09A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

E09A2009-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit

E09A2009-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

E04A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

E04A2009-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit

E04A2009-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

E03A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

E03A2009-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit

E03A2009-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

E07A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

E07A2009-48 1 plate of 48 wells
EUR 520
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit

E07A2009-96 1 plate of 96 wells
EUR 685
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit

E06A2009-192T 192 tests
EUR 1270
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit