Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit
To Order Contact us below: zachary@wildpalm.net
Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Antibody |
20-abx130708 |
Abbexa |
-
EUR 376.80
-
EUR 159.60
-
EUR 978.00
-
EUR 510.00
-
EUR 326.40
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
abx025732-400ul |
Abbexa |
400 ul |
EUR 627.6 |
|
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
abx025732-80l |
Abbexa |
80 µl |
EUR 343.2 |
|
beta Carotene-15,15'-Monooxygenase 1 (BCMO1) Antibody |
abx230851-100ug |
Abbexa |
100 ug |
EUR 577.2 |
|
Recombinant Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) |
4-RPE246Hu01 |
Cloud-Clone |
-
EUR 582.34
-
EUR 279.60
-
EUR 1853.76
-
EUR 697.92
-
EUR 1275.84
-
EUR 465.60
-
EUR 4454.40
|
- 100 ug
- 10ug
- 1 mg
- 200 ug
- 500 ug
- 50ug
- 5 mg
|
|
Description: Recombinant Human Beta-Carotene-15,15'-Monooxygenase 1 expressed in: E.coli |
Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
20-abx150797 |
Abbexa |
-
EUR 8853.60
-
EUR 4719.60
-
EUR 1093.20
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
SEE246Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5677.8 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
SEE246Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 572.76 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
SEE246Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 766.8 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) ELISA Kit |
SEE246Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 3090.6 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) in tissue homogenates, cell lysates and other biological fluids. |
Human Beta,beta- carotene 15,15'- monooxygenase, BCMO1 ELISA KIT |
ELI-10937h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human Beta-Carotene-15,15'-Monooxygenase 1 (bCMO1) Protein |
20-abx650585 |
Abbexa |
-
EUR 811.20
-
EUR 343.20
-
EUR 2498.40
-
EUR 961.20
-
EUR 577.20
|
- 100 ug
- 10 ug
- 1 mg
- 200 ug
- 50 ug
|
|
Mouse Beta,beta- carotene 15,15'- monooxygenase, Bcmo1 ELISA KIT |
ELI-11036m |
Lifescience Market |
96 Tests |
EUR 1038 |
Human beta Carotene-15,15'-Monooxygenase 1 (bCMO1) CLIA Kit |
20-abx494551 |
Abbexa |
-
EUR 9567.60
-
EUR 5095.20
-
EUR 1177.20
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
ELISA kit for Human bCMO1 (Beta-Carotene-15,15'-Monooxygenase 1) |
ELK4791 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A sandwich ELISA kit for detection of Beta-Carotene-15,15'-Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) ELISA Kit |
4-SEE246Hu |
Cloud-Clone |
-
EUR 5738.40
-
EUR 3031.20
-
EUR 768.00
|
- 10 plates of 96 wells
- 5 plates of 96 wells
- 1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) in samples from tissue homogenates, cell lysates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human) |
4-PAE246Hu01 |
Cloud-Clone |
-
EUR 296.40
-
EUR 3012.00
-
EUR 750.00
-
EUR 372.00
-
EUR 256.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC |
4-PAE246Hu01-APC |
Cloud-Clone |
-
EUR 414.00
-
EUR 3930.00
-
EUR 1094.40
-
EUR 528.00
-
EUR 262.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Biotinylated |
4-PAE246Hu01-Biotin |
Cloud-Clone |
-
EUR 373.20
-
EUR 2952.00
-
EUR 872.40
-
EUR 457.20
-
EUR 262.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Biotin. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), Cy3 |
4-PAE246Hu01-Cy3 |
Cloud-Clone |
-
EUR 502.80
-
EUR 5190.00
-
EUR 1410.00
-
EUR 654.00
-
EUR 301.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with Cy3. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), FITC |
4-PAE246Hu01-FITC |
Cloud-Clone |
-
EUR 355.20
-
EUR 3168.00
-
EUR 900.00
-
EUR 446.40
-
EUR 234.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with FITC. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), HRP |
4-PAE246Hu01-HRP |
Cloud-Clone |
-
EUR 379.20
-
EUR 3426.00
-
EUR 968.40
-
EUR 477.60
-
EUR 247.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with HRP. |
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), PE |
4-PAE246Hu01-PE |
Cloud-Clone |
-
EUR 355.20
-
EUR 3168.00
-
EUR 900.00
-
EUR 446.40
-
EUR 234.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with PE. |
Human Beta,beta-carotene 15,15'-dioxygenase (BCO1) ELISA Kit |
abx392200-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Mouse Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
abx388677-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Rat Beta,beta-Carotene 15,15-Dioxygenase (BCO1) ELISA Kit |
abx391017-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1) Polyclonal Antibody (Human), APC-Cy7 |
4-PAE246Hu01-APC-Cy7 |
Cloud-Clone |
-
EUR 685.20
-
EUR 7716.00
-
EUR 2046.00
-
EUR 912.00
-
EUR 382.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Rabbit polyclonal antibody against Human Beta-Carotene-15, 15'-Monooxygenase 1 (bCMO1). This antibody is labeled with APC-Cy7. |
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody |
20-abx310811 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (HRP) |
20-abx310812 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (FITC) |
20-abx310813 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Beta,beta-Carotene 15,15'-Dioxygenase (BCO1) Antibody (Biotin) |
20-abx310814 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Beta-Carotene |
TB0299 |
ChemNorm |
8XX100mg |
EUR 328.8 |
Custom Antibody titration by ELISA up to 2 rabbits and 1 bleed |
ELISA-1 |
Alpha Diagnostics |
1 |
EUR 242.4 |
Human BCO2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
E0265Hu |
Sunlong |
1 Kit |
EUR 726 |
ELISA kit for Human Beta,beta-carotene 9',10'-oxygenase |
EK2713 |
SAB |
96 tests |
EUR 663.6 |
Description: Enzyme-linked immunosorbent assay kit for quantification of Human Beta,beta-carotene 9',10'-oxygenase in samples from serum, plasma, tissue homogenates and other biological fluids. |
Human Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
abx250481-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Human BCO2(Beta,beta-carotene 9',10'-oxygenase) ELISA Kit |
EH1224 |
FN Test |
96T |
EUR 681.12 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.469 ng/ml |
Human Beta,beta- carotene 9',10'- oxygenase, BCO2 ELISA KIT |
ELI-49386h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human beta,beta-carotene 9',10'-oxygenase,BCO2 ELISA Kit |
YLA1496HU-48T |
Shanghai YL Biotech |
48T |
EUR 435 |
Human beta,beta-carotene 9',10'-oxygenase,BCO2 ELISA Kit |
YLA1496HU-96T |
Shanghai YL Biotech |
96T |
EUR 562.5 |
Mouse Bco2/ Beta,beta-carotene 9',10'-oxygenase ELISA Kit |
E0170Mo |
Sunlong |
1 Kit |
EUR 758.4 |
Mouse Beta,beta-Carotene 9',10'-Oxygenase (BCO2) ELISA Kit |
abx515122-96tests |
Abbexa |
96 tests |
EUR 886.8 |
|
Mouse Beta,beta- carotene 9',10'- oxygenase, Bco2 ELISA KIT |
ELI-49387m |
Lifescience Market |
96 Tests |
EUR 1038 |
Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
EI2200-1 |
AssayPro |
96 Well Plate |
EUR 572.4 |
BCMO1 ELISA Kit (Human) (OKCD04382) |
OKCD04382 |
Aviva Systems Biology |
96 Wells |
EUR 997.2 |
Description: Description of target: Vitamin A metabolism is important for vital processes such as vision, embryonic development, cell differentiation, and membrane and skin protection. The protein encoded by this gene is a key enzyme in beta-carotene metabolism to vitamin A. It catalyzes the oxidative cleavage of beta,beta-carotene into two retinal molecules.;Species reactivity: Human;Application: ;Assay info: Assay Methodology: Quantitative Sandwich ELISA;Sensitivity: 0.49 ng/mL |
Human TGF-beta-1 AssayMax ELISA Kit |
ET3102-1 |
AssayPro |
96 Well Plate |
EUR 572.4 |
Human Retinyl palmitate beta-carotene co-enzyme (Q-10) ELISA Kit |
YLA4102HU-48T |
Shanghai YL Biotech |
48T |
EUR 435 |
Human Retinyl palmitate beta-carotene co-enzyme (Q-10) ELISA Kit |
YLA4102HU-96T |
Shanghai YL Biotech |
96T |
EUR 562.5 |
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
abx122472-100ug |
Abbexa |
100 ug |
EUR 469.2 |
|
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
20-abx003844 |
Abbexa |
-
EUR 493.20
-
EUR 710.40
-
EUR 218.40
-
EUR 376.80
|
- 100 ul
- 200 ul
- 20 ul
- 50 ul
|
|
Beta,beta-Carotene 9',10'-Oxygenase (BCO2) Antibody |
abx230852-100ug |
Abbexa |
100 ug |
EUR 577.2 |
|
Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit |
EMI2200-1 |
AssayPro |
96 Well Plate |
EUR 572.4 |
YWHAB Tyr-3/Trp- 5 Monooxygenase Activation Protein Beta Human Recombinant Protein |
PROTP31946-1 |
BosterBio |
Regular: 25ug |
EUR 380.4 |
Description: YWHAB Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 246 amino acids (1-246) and having a molecular mass of 28kDa. ;YWHAB is purified by proprietary chromatographic techniques. |
alpha-Carotene |
TBZ2607 |
ChemNorm |
5mg |
Ask for price |
Human Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
abx385151-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Human Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
ELI-23191h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
DLR-FMO1-Hu-48T |
DL Develop |
48T |
EUR 620.4 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
DLR-FMO1-Hu-96T |
DL Develop |
96T |
EUR 807.6 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from tissue homogenates or other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
20-abx151570 |
Abbexa |
-
EUR 8853.60
-
EUR 4719.60
-
EUR 1093.20
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Human Monooxygenase DBH Like 1 (MOXD1) ELISA Kit |
abx381498-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
RD-FMO1-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 625.2 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
RD-FMO1-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 867.6 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
RDR-FMO1-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 652.8 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
RDR-FMO1-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 907.2 |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
SEF458Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5677.8 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
SEF458Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 572.76 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
SEF458Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 766.8 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
SEF458Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 3090.6 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in Tissue homogenates and other biological fluids. |
Human Flavin Containing Monooxygenase 1 (FMO1) ELISA Kit |
4-SEF458Hu |
Cloud-Clone |
-
EUR 5738.40
-
EUR 3031.20
-
EUR 768.00
|
- 10 plates of 96 wells
- 5 plates of 96 wells
- 1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Flavin Containing Monooxygenase 1 (FMO1) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
BCMO1 siRNA |
20-abx909008 |
Abbexa |
|
|
|
BCMO1 siRNA |
20-abx909009 |
Abbexa |
|
|
|
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E01A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E01A2009-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E01A2009-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Human Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit |
201-12-2419 |
SunredBio |
96 tests |
EUR 528 |
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human Squalene monooxygenase, SQLE ELISA KIT |
ELI-32784h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human SQLE/ Squalene monooxygenase ELISA Kit |
E2385Hu |
Sunlong |
1 Kit |
EUR 726 |
Human Alkylglycerol monooxygenase, AGMO ELISA KIT |
ELI-24195h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit |
YLA3108HU-48T |
Shanghai YL Biotech |
48T |
EUR 435 |
Human Alkylglycerol Monooxygenase (AGMO)ELISA Kit |
YLA3108HU-96T |
Shanghai YL Biotech |
96T |
EUR 562.5 |
ExoAb Antibody Kit (CD9, CD63, CD81, Hsp70 antibodies, rabbit anti-human) with goat anti-rabbit HRP secondary antibody |
EXOAB-KIT-1 |
SBI |
25 ul each |
EUR 752.4 |
|
Human BCMO1 shRNA Plasmid |
20-abx959976 |
Abbexa |
|
|
|
BCMO1 Recombinant Protein (Human) |
RP036973 |
ABM |
100 ug |
Ask for price |
BCMO1 Recombinant Protein (Human) |
RP036976 |
ABM |
100 ug |
Ask for price |
mRNAExpress mRNA Synthesis kit (5 reactions) |
MR-KIT-1 |
SBI |
5 reactions |
EUR 1382.4 |
|
Rat Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
abx391608-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Mouse Methylsterol monooxygenase 1 (MSMO1) ELISA Kit |
abx389876-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Porcine Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
ELI-42078p |
Lifescience Market |
96 Tests |
EUR 1113.6 |
Mouse Methylsterol monooxygenase 1, Msmo1 ELISA KIT |
ELI-45646m |
Lifescience Market |
96 Tests |
EUR 1038 |
Chicken Methylsterol monooxygenase 1, MSMO1 ELISA KIT |
ELI-23404c |
Lifescience Market |
96 Tests |
EUR 1113.6 |
Human Beta-2-Microglobulin (B2M) AssayMax ELISA Kit |
EM5001-1 |
AssayPro |
96 Well Plate |
EUR 500.4 |
Msmo1 ELISA Kit| Rat Methylsterol monooxygenase 1 ELISA Kit |
EF018966 |
Lifescience Market |
96 Tests |
EUR 826.8 |
MSMO1 ELISA Kit| chicken Methylsterol monooxygenase 1 ELISA Kit |
EF012392 |
Lifescience Market |
96 Tests |
EUR 826.8 |
Msmo1 ELISA Kit| Mouse Methylsterol monooxygenase 1 ELISA Kit |
EF015513 |
Lifescience Market |
96 Tests |
EUR 826.8 |
PinPoint-FC 293T Platform Kit for Targeted Gene Insertion (includes PIN320A-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
PIN320A-KIT |
SBI |
1 Kit |
EUR 5929.2 |
|
ELISA kit for Human FMO1 (Flavin Containing Monooxygenase 1) |
ELK4594 |
ELK Biotech |
1 plate of 96 wells |
EUR 518.4 |
|
Description: A sandwich ELISA kit for detection of Flavin Containing Monooxygenase 1 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Human DBH- like monooxygenase protein 1, MOXD1 ELISA KIT |
ELI-43781h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
abx332554-100ul |
Abbexa |
100 ul |
EUR 510 |
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
20-abx329250 |
Abbexa |
|
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
20-abx241015 |
Abbexa |
|
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
20-abx241094 |
Abbexa |
|
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
20-abx214774 |
Abbexa |
|
|
|
Tyrosine 3-Monooxygenase/tryptophan 5-Monooxygenase Activation Protein Beta (YWHAB) Antibody |
20-abx214826 |
Abbexa |
|
|
|
Rat Kynurenine 3-monooxygenase(KMO) ELISA kit |
1-CSB-EL012475RA |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Rat Kynurenine 3-monooxygenase(KMO) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
PinPoint-FC Murine iPSC Platform Kit for Targeted Gene Insertion (includes PIN340iPS-1, PIN200A-1, PIN510A-1 & PIN600A-1) |
PIN340iPS-KIT |
SBI |
1 Kit |
EUR 5929.2 |
|
Amyloid Beta-Peptide (1-40) (human) |
A1124-1 |
ApexBio |
1 mg |
EUR 226.8 |
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
Recombinant Human Heregulin Beta -1 Protein |
PROTQ02297-1 |
BosterBio |
50ug |
EUR 380.4 |
Description: Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-β1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-β1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-β1 (HRG1-β1) is a 7.5 kDa polypeptide consisting of only the EGF domain of Heregulin-β1 (65 amino acid residues). |
BCMO1 sgRNA CRISPR Lentivector (Human) (Target 1) |
K0177302 |
ABM |
1.0 ug DNA |
EUR 184.8 |
Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
E01K0092-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
E01K0092-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Kynurenine 3 monooxygenase(KMO) ELISA kit |
E01K0092-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Human Kynurenine 3 monooxygenase(KMO) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human KMO/ Kynurenine 3-monooxygenase ELISA Kit |
E1395Hu |
Sunlong |
1 Kit |
EUR 726 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
DLR-KMO-Hu-48T |
DL Develop |
48T |
EUR 620.4 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
DLR-KMO-Hu-96T |
DL Develop |
96T |
EUR 807.6 |
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from tissue homogenates or other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
20-abx152142 |
Abbexa |
-
EUR 8853.60
-
EUR 4719.60
-
EUR 1093.20
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Human Kynurenine 3-monooxygenase (KMO) ELISA Kit |
abx573591-96tests |
Abbexa |
96 tests |
EUR 801.6 |
|
Human Coenzyme Q6, Monooxygenase (COQ6) ELISA Kit |
abx386638-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
ELISA kit for Human Squalene monooxygenase (SQLE) |
KTE60353-48T |
Abbkine |
48T |
EUR 398.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Squalene monooxygenase (SQLE) |
KTE60353-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2538 |
|
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Squalene monooxygenase (SQLE) |
KTE60353-96T |
Abbkine |
96T |
EUR 646.8 |
|
Description: Quantitative sandwich ELISA for measuring Human Squalene monooxygenase (SQLE) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
Human KMO(Kynurenine 3-monooxygenase) ELISA Kit |
EH14776 |
FN Test |
96T |
EUR 681.12 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
Human TH(Tyrosine 3-monooxygenase) ELISA Kit |
EH1602 |
FN Test |
96T |
EUR 628.92 |
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.188 ng/ml |
Human Kynurenine 3- monooxygenase, KMO ELISA KIT |
ELI-46405h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human TH/ Tyrosine 3-monooxygenase ELISA Kit |
E2487Hu |
Sunlong |
1 Kit |
EUR 685.2 |
Human Tyrosine 3- monooxygenase, TH ELISA KIT |
ELI-04696h |
Lifescience Market |
96 Tests |
EUR 988.8 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
RD-KMO-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 625.2 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
RD-KMO-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 867.6 |
Human Deoxyhypusine Hydroxylase/Monooxygenase(DOHH)ELISA Kit |
QY-E01153 |
Qayee Biotechnology |
96T |
EUR 433.2 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
RDR-KMO-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 652.8 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
RDR-KMO-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 907.2 |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
SEH755Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 5677.8 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
SEH755Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 572.76 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
SEH755Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 766.8 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
SEH755Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 3090.6 |
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Kynurenine-3-Monooxygenase (KMO) in Tissue homogenates and other biological fluids. |
Human Kynurenine-3-Monooxygenase (KMO) ELISA Kit |
4-SEH755Hu |
Cloud-Clone |
-
EUR 5738.40
-
EUR 3031.20
-
EUR 768.00
|
- 10 plates of 96 wells
- 5 plates of 96 wells
- 1 plate of 96 wells
|
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Kynurenine-3-Monooxygenase (KMO) in samples from Tissue homogenates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
BCMO1 cloning plasmid |
CSB-CL864015HU1-10ug |
Cusabio |
10ug |
EUR 451.2 |
|
Description: A cloning plasmid for the BCMO1 gene. |
BCMO1 cloning plasmid |
CSB-CL864015HU2-10ug |
Cusabio |
10ug |
EUR 684 |
|
Description: A cloning plasmid for the BCMO1 gene. |
anti- BCMO1 antibody |
FNab00851 |
FN Test |
100µg |
EUR 606.3 |
|
Description: Antibody raised against BCMO1 |
BCMO1 Rabbit pAb |
A15848-100ul |
Abclonal |
100 ul |
EUR 369.6 |
BCMO1 Rabbit pAb |
A15848-200ul |
Abclonal |
200 ul |
EUR 550.8 |
BCMO1 Rabbit pAb |
A15848-20ul |
Abclonal |
20 ul |
EUR 219.6 |
BCMO1 Rabbit pAb |
A15848-50ul |
Abclonal |
50 ul |
EUR 267.6 |
BCMO1 Polyclonal Antibody |
29452-100ul |
SAB |
100ul |
EUR 302.4 |
BCMO1 Polyclonal Antibody |
29452-50ul |
SAB |
50ul |
EUR 224.4 |
BCMO1 Polyclonal Antibody |
A72807-050 |
EpiGentek |
50 ul |
EUR 302.5 |
BCMO1 Polyclonal Antibody |
A72807-100 |
EpiGentek |
100 ul |
EUR 423.5 |
Human Integrin beta-1(ITGB1) ELISA kit |
1-CSB-EL011880HU |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Integrin beta-1(ITGB1) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Lithostathine-1-beta(REG1B) ELISA kit |
1-CSB-EL019547HU |
Cusabio |
-
EUR 964.80
-
EUR 6118.80
-
EUR 3244.80
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Lithostathine-1-beta(REG1B) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Beta-Amyloid (1-11) |
A1002-1 |
ApexBio |
1 mg |
EUR 122.4 |
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein. |
BCMO1 ORF Vector (Human) (pORF) |
ORF012325 |
ABM |
1.0 ug DNA |
EUR 424.8 |
BCMO1 ORF Vector (Human) (pORF) |
ORF012326 |
ABM |
1.0 ug DNA |
EUR 424.8 |
Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
E01D0299-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
E01D0299-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) ELISA kit |
E01D0299-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Human Dimethylaniline monooxygenase [N oxide forming] 1(FMO1) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
KTE61571-48T |
Abbkine |
48T |
EUR 398.4 |
|
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
KTE61571-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2538 |
|
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human DBH-like monooxygenase protein 1 (MOXD1) |
KTE61571-96T |
Abbkine |
96T |
EUR 646.8 |
|
Description: Quantitative sandwich ELISA for measuring Human DBH-like monooxygenase protein 1 (MOXD1) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
pPACK-SPIKE Beta Combo Kit, includes Cat# CVD19-640A-1, plus PureFection Transfection Reagent (Cat# LV750A-1) and PEG-it Virus Concentration solution (Cat# LV810A-1) |
CVD19-649A-KIT |
SBI |
1 kit |
EUR 1141 |
Mouse Cholesterol 7-alpha-monooxygenase(CYP7A1) ELISA kit |
1-CSB-EL006460MO |
Cusabio |
-
EUR 843.60
-
EUR 5811.60
-
EUR 3084.00
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Cholesterol 7-alpha-monooxygenase(CYP7A1) in samples from serum, plasma, tissue homogenates, cell lysates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Human Kynurenine 3-monooxygenase (KMO) |
1-CSB-EP012475HU |
Cusabio |
-
EUR 456.00
-
EUR 256.80
-
EUR 1570.80
-
EUR 672.00
-
EUR 1047.60
-
EUR 314.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli |
Human Kynurenine 3-monooxygenase (KMO) |
1-CSB-EP012475HUa0 |
Cusabio |
-
EUR 456.00
-
EUR 256.80
-
EUR 1570.80
-
EUR 672.00
-
EUR 1047.60
-
EUR 314.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli |
Human Kynurenine 3-monooxygenase (KMO) |
1-CSB-EP012475HUb0 |
Cusabio |
-
EUR 456.00
-
EUR 256.80
-
EUR 1570.80
-
EUR 672.00
-
EUR 1047.60
-
EUR 314.40
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in E.coli |
Human Kynurenine 3-monooxygenase (KMO) |
1-CSB-YP012475HU |
Cusabio |
-
EUR 516.00
-
EUR 280.80
-
EUR 1809.60
-
EUR 770.40
-
EUR 1210.80
-
EUR 349.20
|
- 100ug
- 10ug
- 1MG
- 200ug
- 500ug
- 50ug
|
|
Description: Recombinant Human Kynurenine 3-monooxygenase(KMO) expressed in Yeast |
IL-1-beta Interleukin-1 beta Mouse Recombinant Protein, His Tag |
PROTP10749-1 |
BosterBio |
Regular: 25ug |
EUR 380.4 |
Description: Interleukin-1 beta Mouse Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 189 amino acids and having a molecular mass of 21 kDa. ;The IL-1b is fused to His-Tag and purified by proprietary chromatographic techniques. |
T7 gRNA SmartNuclease Synthesis Kit (includes CAS510A-1 & T7 IVT synthesis reagents) |
CAS510A-KIT |
SBI |
1 Kit |
EUR 966 |
|
PinPoint-FC System for Platform Cell Line Generation & Retargeting (includes PIN300A-1, FC200PA-1, PIN200A-1, PIN510A-1, & PIN600A-1) |
PIN300A-KIT |
SBI |
1 Kit |
EUR 3357.6 |
|
Human Flavin Containing Monooxygenase 1 (FMO1) CLIA Kit |
20-abx494912 |
Abbexa |
-
EUR 9567.60
-
EUR 5095.20
-
EUR 1177.20
|
- 10 × 96 tests
- 5 × 96 tests
- 96 tests
|
|
Human SIRP BETA 1 (SIRP BETA 1) ELISA Kit |
abx259843-96tests |
Abbexa |
96 tests |
EUR 1093.2 |
|
Human Beta-1, 4-galactosyltransferase 1(B4GALT1) ELISA kit |
1-CSB-EL002513HU |
Cusabio |
-
EUR 843.60
-
EUR 5811.60
-
EUR 3084.00
|
- 1 plate of 96 wells
- 10 plates of 96 wells each
- 5 plates of 96 wells each
|
|
Description: Quantitativesandwich ELISA kit for measuring Human Beta-1, 4-galactosyltransferase 1(B4GALT1) in samples from serum, plasma, cell lysates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
ITGB1 Human, Integrin Beta 1 Human Recombinant Protein, Sf9 |
PROTP05556-1 |
BosterBio |
Regular: 10ug |
EUR 380.4 |
Description: ITGB1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 716 amino acids (1-728) and having a molecular mass of 79.4kDa (Molecular size on SDS-PAGE will appear at approximately 70-100kDa). ITGB1 is fused to an 8 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.  |
Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E02A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E02A2009-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E02A2009-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Rat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E07A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E07A2009-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E07A2009-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Porcine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E08A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E08A2009-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E08A2009-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Canine Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E09A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E09A2009-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Monkey Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E09A2009-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Monkey Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E03A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E03A2009-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E03A2009-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Mouse Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E06A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E06A2009-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E06A2009-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A sandwich ELISA for quantitative measurement of Goat Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Alkylglycerol monooxygenase(TMEM195) ELISA kit |
E04A2009-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A sandwich ELISA for quantitative measurement of Rabbit Alkylglycerol monooxygenase(TMEM195) in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human bCMO1(Beta-Carotene-15,15′-Monooxygenase 1) ELISA Kit